DPCstruct | MC19376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 147 ± 32 aa |
| Standard deviation of domain lengths | 32.03 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9K1K8 | 230-357 | SWQIRISREDLSRRVNQFYPIGKLMDLIPQKRGASRRVVELAVIGQEGRALVRGLKIRQVLNLRDNLFVIDRETDGEGRLTHFLFSG… |
| A0A7C2IZV6 | 53-193 | PENPHYGWSVRYSVYELAACLTAKDYPFSVVTEVYEIERTASGSSRLKRVEVVGLDQNGQPQRQPLGNADLVRVVFRLKSLPAAMSK… |
| A0A143PQM3 | 625-752 | None |
| A0A1H0C2N8 | 999-1144 | None |
| A0A7Z9W0L5 | 177-346 | None |
| R5LRU9 | 222-343 | None |
| A0A1T4PGK0 | 729-934 | None |
| T0CUH2 | 123-242 | None |
| R6Y4D5 | 288-410 | None |
| A0A521TZC8 | 190-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.