DPCstruct | MC19375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1SNI1 | 55-138 | ANFIASMAGALMYFATLTEVPIMQGLIGAGMGQGPALALLLAGPTLSLPSILVINSELGPKKTITYVGLVIVISTLAGKIFGLI |
| A0A7X9JYR4 | 1-86 | ANLFASVSGALMYFATLTEVPILQGLIGSGMGQGPALALLLAGPALSLPSMIVIGKIMGTRKTAVYVSLVIFMATATGLIFGAFSR |
| A0A7V4J098 | 205-283 | None |
| A0A7C5RIK5 | 1-82 | None |
| A0A7C6ANP6 | 245-318 | None |
| A0A2M7AFE6 | 148-222 | None |
| A0A823ZK76 | 19-95 | None |
| A0A7V3WPG3 | 295-378 | None |
| A0A7D4AW73 | 365-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.