DPCstruct | MC1937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 456 ± 97 aa |
| Standard deviation of domain lengths | 96.70 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.40 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0063- CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0WXL0 | 51-491 | APLHLAEAVTALKMLTRGGSFILKMFTMFEHTSVDLLYLLYVCFDELNVFKPCTSKPGNSEVYVIAKGYRRPDGIDAYLDRMFANLS… |
| A0A6G0T0Y7 | 4-452 | KKNLGGTFVLKMFTMFECNSLCRIYLLCCAFDSVQIKKPVTSKQGNSEVYIVCCGYKGLQHVEPWIHTYFATIDRTVSDYCLFPLKE… |
| A0A812C1G3 | 109-621 | None |
| A0A0L7L1G0 | 1-317 | None |
| A9UR32 | 368-925 | None |
| A0A0B2VEZ8 | 362-854 | None |
| A0A7J6ANN2 | 265-642 | None |
| A0A7D9LKA3 | 155-839 | None |
| T1GTS7 | 216-664 | None |
| E4X3F5 | 3-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.