DPCstruct | MC19369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 20 aa |
| Standard deviation of domain lengths | 19.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 67.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.63 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF05901- PF03229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7HYV3 | 6-98 | TAMLAIVPLAGAAHAADLDCKDFKYQEDAQRVYNQDPSDPNHLDADHDGIACEHLPHRPGGTNGGASGDNGTQPQGGVETGAGGMAP… |
| A0A7V9B1M8 | 19-98 | AVAVPVGARQALDCADFAGQREAQVTLNADHSDPENLDGDGDGIACEDFFGGIGMPLNGSDVSAAAEDTAGDVTDLPDTG |
| A0A229RYM6 | 37-142 | None |
| A0A4R6UIJ9 | 16-117 | None |
| A0A6G8Q2Z2 | 4-120 | None |
| A0A6G8Q1M4 | 1-138 | None |
| A0A366ZW24 | 1-101 | None |
| A0A542DLW1 | 7-102 | None |
| A0A7W1I5H1 | 9-109 | None |
| A0A7H8S763 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.