DPCstruct | MC19360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0UAP9 | 20-120 | GAGDQLRVIYSQLSRDPNSLANLDQDLPNYAQHGVPIFSLPQEWLWCETWCSGETKATAKTIDLCNNPMTKEPKLDQAKRIIAEWTE… |
| A0A6J2WGB4 | 20-127 | DRLRGQYQDPNSLSNLDQDLPNNMIHQVAIKSLPQDWLWCETWCDDTSKATAKTIDLCNNPKTKEPKLKAAVRIVPEWSRYDSEVKQ… |
| A0A7J5Y7N8 | 352-473 | None |
| S7NF93 | 1-102 | None |
| A0A078A8C5 | 895-1008 | None |
| A0A6A6N2F5 | 751-859 | None |
| Q0DYW4 | 116-228 | None |
| A0A1B7NXC8 | 365-490 | None |
| A0A3Q0KM82 | 1325-1436 | None |
| A0A6A4NDZ5 | 325-425 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.