DPCstruct | MC19359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 484 ± 112 aa |
| Standard deviation of domain lengths | 112.31 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.11 |
| Pfam Score | 77.47 |
| Assigned Pfam label(s) | CL0257- PF07965- CL0128- PF08725- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0FWY8 | 52-476 | KNQMRLTQNTHRFSKEVQEAQISGNLDAPEGGFDAVMQTLTCNKSIGWRERARKMIVFSTDAGFHYAGDGRLAGVVTPNDGQCHLDD… |
| A0A6J2WG71 | 146-661 | AKLRQAVLTAVQEVNAKAVSTGSGLFGEEQKQGCKESVCGKVLHLTHSSHGPPGAPHSEGTSSHGGLQALLQTALCRDEISKEQDPW… |
| A0A0C2IMW7 | 48-364 | None |
| A0A0C2J525 | 94-556 | None |
| A0A0C2JQA2 | 142-549 | None |
| A0A212CIL6 | 135-695 | None |
| A0A498NY70 | 380-864 | None |
| F1RA51 | 134-730 | None |
| A0A1X7SEP6 | 2-346 | None |
| A0A7J5YV27 | 171-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.