DPCstruct | MC19352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 156 ± 14 aa |
| Standard deviation of domain lengths | 14.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7AX84 | 1-168 | MDLHTNQTMYSCGSLAPKMGRGGGCMDHKFRKPSEPWELADGCVNLLAELSHVPSASKQVNQLIPVMANACNTKSYTHYPNFMETVC… |
| A0A059LER6 | 198-358 | APGKGERPFSWGALTPAVARGADCCVDHGYSKPPEAWERAEGGVHLARELAGLQPETVVKRLPRIAELASLNQFAGSLALKRAVWRS… |
| T1F4S4 | 553-721 | None |
| A0A7S1VG05 | 61-185 | None |
| A0A1D1ZPJ4 | 350-512 | None |
| A0A2K3CNJ0 | 588-735 | None |
| A0A7T8GMQ1 | 182-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.