DPCstruct | MC19348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 192 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5MU01 | 60-245 | KNTQSNSESESKDVSTDDCLPGVSLEMWKKFKELKHKHLEMKKKPQSKVRHRKRKRHKKDEKTVSMEPEKESMLQAEREAHWNELKQ… |
| A0A0B7ARG9 | 1-219 | MMEEQSDTINKSTDTTTSTSIQPKNVSARLWEKFKTLEKRTNEVTQKSTDKRIRQLQKQVMDTVKQEFTSAEDKAILEKCDLKLVQQ… |
| A0A4V5P9Q6 | 3-148 | None |
| A0A6P7U4T7 | 1-194 | None |
| A0A401RVQ1 | 16-226 | None |
| A0A2B4SKZ4 | 1-220 | None |
| H2YII8 | 3-193 | None |
| A0A3B3R217 | 41-212 | None |
| A0A6J3Q5B8 | 28-213 | None |
| A0A672TPX8 | 44-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.