DPCstruct | MC19346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 133 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7AII0 | 21-153 | EAKMRKQETEIDYLAPFLAQMGDPDKINRHNAIKLKEDCLADLKHRLIDKANLIQSRFEMETQELQKKQAWYQQNLVSMSKDDEQEY… |
| A0A7F8Q965 | 11-136 | AQLDYLAPFLAQLPPGEKLTRWQAMRVKDECLSDFKQRLIDKANLIQARFEKETQELQKKQQWYQENQVTLTAEDEDWYLSYCSQAM… |
| H2YT26 | 288-425 | None |
| S7PUL0 | 140-278 | None |
| A0A397CGE2 | 26-158 | None |
| A0A7S0R7H1 | 1088-1223 | None |
| A0A7J6QBY9 | 1-124 | None |
| A0A5A8CLH0 | 1076-1202 | None |
| A0A6T8P641 | 442-575 | None |
| A0A4C1TV38 | 169-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.