DPCstruct | MC19345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 418 ± 64 aa |
| Standard deviation of domain lengths | 63.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.79 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF14838- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7NL80 | 500-965 | LNNVFGAISAVTELPQLVQMLRNFERVILGEKKRARLLTALSSFLLEAMQKELGKLSDILLHPNIEVSMCGLRLLETVGVPATTEMP… |
| A0A0B7AFA4 | 1-403 | MAGVPPDLSTSLLTRLCGVISLSFFASLHKRVLDTVLESTTKSNRMTQLCISCIEQLSGLPFTRSLLIHYLVEGAIQEDHCHLFGGR… |
| A0A819M713 | 19-443 | None |
| A0A177BAB8 | 510-860 | None |
| T1PHE5 | 2-515 | None |
| A0A813T4E8 | 440-885 | None |
| A0A1Y3ESG1 | 2-322 | None |
| A0A2H1V049 | 208-498 | None |
| F7BN02 | 176-659 | None |
| A0A2H2IW58 | 412-842 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.