DPCstruct | MC19344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 67.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.88 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 45.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0TSC7 | 1-112 | MEGEPIRGGTRGGAGNFSWNAVKEDKHREYYLGHSVKAAAGRWQKNKDIHWYNRDQDSGDEEEVKRKKKAEIQKIKEAEEDALSLAL… |
| A0A1X0R7G5 | 1-130 | MFHPTRGGTRGGRDQFSWEDVKQDKHRENYLGHSLMAPVGRWQKGKDLQWYTKKATDDAKAKADKSELQKIKEAEAEAMAIALGVRK… |
| A0A0D3H363 | 1-98 | None |
| A0A4U0VU52 | 1-148 | None |
| S3BM23 | 1-129 | None |
| A0A4S9U7B5 | 60-185 | None |
| A0A2T3AJQ1 | 5-114 | None |
| A0A1E3J016 | 1-111 | None |
| A0A674H621 | 403-535 | None |
| A0A4D8ZKK9 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.