DPCstruct | MC19340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 137 ± 26 aa |
| Standard deviation of domain lengths | 25.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 37.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162TNB9 | 206-368 | LPPTLKLQSPSAVKNHFESIREAGFTTFLQSNTQVLIQACRPVLGVDPILFLPASRVERGRLIRWRMGWLPGKPKECPCGSDHTSRR… |
| A0A1X0QY88 | 13-130 | KHSKLLSHCRNDLIVGPILRIPMTRSERSRCVRWRLGWLPLGKFQVCPFHPNELFSRQHSFSCLDMHNRPQMPKSIDDPLSYLLNLL… |
| I1CQ56 | 1-79 | None |
| A0A077WW84 | 53-187 | None |
| I1CQQ0 | 125-224 | None |
| A0A162ZVF6 | 46-216 | None |
| A0A1X0S0U7 | 17-111 | None |
| I1C9D1 | 14-121 | None |
| A0A1X0S5U0 | 37-168 | None |
| I1BN83 | 130-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.