DPCstruct | MC1934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178T8P4 | 1-79 | MRVNGGFPYITVNDGDYMRNGELYLKHWYEGIELDLKYLEKVLPYIYQLWGRPVHMETVVEEKPMLFTYDGKKVHRKYL |
| H7GDN7 | 41-101 | PLVELLDANHGNRGELLLAHAYEGVELDLKKTKAVLENLHRLWGRPVHLKTVVGGKEVLLS |
| A0A535RWS7 | 552-626 | None |
| A0A7V1AMH5 | 309-383 | None |
| A0A1F8F866 | 180-256 | None |
| A0A7X7HID5 | 262-332 | None |
| A0A7C5N7P2 | 445-517 | None |
| A0A7V0KSV1 | 225-295 | None |
| A0A1B8VXN1 | 1-69 | None |
| A0A1G2PXX4 | 352-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.