DPCstruct | MC19339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 311 ± 42 aa |
| Standard deviation of domain lengths | 41.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF21009- CL0028- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0QMN9 | 3-289 | SKNEVFSRNLGQQFKTFTKKLPFDQCVHSSYQSALKSRIISACEDTRQVVFRAQLFINQYILNLKVHSNHIFKQNFWYSICQLVMDK… |
| A0A662Y9K8 | 24-309 | VARKDLNKVTDFSVVKTTLNKFCKSKARALPWDEVLADMNKGVLEAYLLANVHVLRLCKAGLPIPPLTNTFFNQCISLVMEMSGARG… |
| K3WN19 | 25-309 | None |
| G4ZRB4 | 22-333 | None |
| A0A1X2GVF6 | 31-417 | None |
| A0A080ZKU3 | 2-246 | None |
| A0A1X2GVJ8 | 89-453 | None |
| A0A1X2GR29 | 91-452 | None |
| A0A1X2GGU6 | 3-314 | None |
| A0A1X2GEC3 | 18-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.