DPCstruct | MC19337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 202 ± 33 aa |
| Standard deviation of domain lengths | 33.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 15.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534ZRR5 | 2-182 | NTAECARRLSDMVKDFEDLDTKHNLVVDCERRGDQLTTEILQRLDSTFVTPFDREDIHALAEELDDVVDDMLAVSDLLRLLSIEAIL… |
| E5VL53 | 5-208 | AKNELRRMANMAQENLDHAIHGFLNQSDEFVDKIYHREEDINNVSHAITDYLVKSNQLLLPLADQKILGSMFYVVNDIERIGDHAEN… |
| A0A7J2K9P7 | 9-219 | None |
| Q53W26 | 284-488 | None |
| T0DYY1 | 4-193 | None |
| A0A842Q9Z5 | 113-326 | None |
| A0A4Y6UM70 | 11-256 | None |
| G2E3E8 | 20-235 | None |
| A0A7Z9WIU9 | 49-228 | None |
| A0A7C5RCI5 | 26-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.