DPCstruct | MC19336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4JH77 | 1-122 | MFGYITVNKDTLSEENKKIYQSYYCGLCQTMKSQYGRRAQMALNYDMTFLIVLLTGLYEPDSVTRDGFVCSVHPTKKRTLRTNEITE… |
| E5VIZ3 | 1-120 | MFGYIIVNKPEMKFREFDVYHGYYCGLCRKLKEHYGKFGQITLSYDMVFVLMTLTSLYEPETTKSMKRCVTHPLHKHEERVNNITDY… |
| A0A6J4III9 | 1-133 | None |
| X7Y2G0 | 1-127 | None |
| A0A7W9L126 | 1-140 | None |
| X8FB75 | 1-103 | None |
| A0A0B8NB74 | 1-125 | None |
| A0A6J4KTR1 | 1-128 | None |
| A8L7I0 | 1-137 | None |
| A0A1L6LY13 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.