DPCstruct | MC19332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A0A413 | 92-182 | EPAPPAASYYVTLRRAEQRPQVEVWPIQLQDRLPTVPVPLSQPDPDASLDLAAAVAAVYERGGYASLIDYRRPPPPPKLSEVDALWL… |
| A0A7V3RRM4 | 9-93 | YAITVTRATQPDRYEIYTTTLQKRLPRFRLPLASDDRDTVLDLHTAFTRCYDQGGFAAKIDYRKDPNTPLSDEDRKWLHELLKQQ |
| B1WQB0 | 6-87 | None |
| H5S9G1 | 43-121 | None |
| A0A1W9X4A9 | 35-116 | None |
| A0A2E8DD29 | 2-81 | None |
| A0A354P7B6 | 1-76 | None |
| A0A846BWL8 | 2-77 | None |
| A0A354P2V1 | 120-220 | None |
| A0A7V5S202 | 9-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.