DPCstruct | MC19331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 181 ± 35 aa |
| Standard deviation of domain lengths | 35.12 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 13.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M8HG88 | 6-217 | TEQKRLKLEIFEHLKPQLVDHGFKLKAAKETFRRQHDGVTDMFQLIFLDNKIDDKPGWRIKLSIAVRVEKVEEIFHQTSNFDQKYQS… |
| A0A7V3RQP6 | 4-150 | LAKLVLRELAEVLKPESFRKKKNRFFHEGPDSILWIEVQKSRDSTDDRYIFTINLGAFLPILARTLGEDIREIDILNGHWNTRLGLL… |
| A0A2R7SKJ8 | 1-150 | None |
| A0A5C7XES3 | 55-210 | None |
| A0A4Q5IW21 | 8-179 | None |
| A0A4Q5J479 | 327-520 | None |
| A0A5N5ZHY1 | 18-213 | None |
| A0A0C9NAI9 | 12-151 | None |
| A0A1M5QWU9 | 264-458 | None |
| A0A2L2K9N9 | 37-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.