DPCstruct | MC19330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 845 |
|---|---|
| Mean domain length (aa) | 313 ± 56 aa |
| Standard deviation of domain lengths | 56.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.05 |
| Pfam Score | 98.64 |
| Assigned Pfam label(s) | PF00786- PF00566- PF11830- CL0063- PF19430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8QAX8 | 49-329 | LPHLKDAIFKGGLCHAVRKEAWKFLLGYFPWSSTHEERKLLQKRKTDEYFRMKLQWKSVSEEQERRNSRLRDYRSLIEKDVNRTDRN… |
| A0A2I1CLP2 | 45-388 | MEIYSSRISRINKFKRLLQTSTVSLSELRNLAWSGIPAEVRAMTWQILLGYLPTNSERRVSTLERKRKEYLDGVRQAFERSTSPASG… |
| A0A6S7NB26 | 474-819 | None |
| A0A2B4SQI5 | 85-422 | None |
| A0A7S4RNW1 | 366-676 | None |
| A0A397FJL7 | 7-220 | None |
| A0A7S2J6U9 | 47-330 | None |
| A0A182F673 | 291-599 | None |
| E7F6L2 | 33-371 | None |
| A0A672URZ6 | 408-714 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.