DPCstruct | MC1933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 62 ± 2 aa |
| Standard deviation of domain lengths | 2.28 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T3DI08 | 10-70 | IVKPVRGLVCCCCGGSITGRQFHNQDTGHGLGDCCVEFVKPRTEDMERTYGVEGVHYLLDP |
| A0A2L0T6Q6 | 28-92 | GHLDAPVRLLCPCCGARTTGRQWGNQDAGHGLCSDCIEKVLAKMTAEEFSKRYGLQGVHFGLSQC |
| A0A6A7N6J7 | 71-133 | None |
| A0A1B8TCW5 | 303-362 | None |
| A0A2P5MHU1 | 6-69 | None |
| A0A0D7K385 | 26-90 | None |
| A0A2E3MWR4 | 66-128 | None |
| A0A0F9C2X2 | 4-69 | None |
| A0A6M3L8A2 | 6-66 | None |
| A0A850QFW5 | 5-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.