DPCstruct | MC19329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 268 ± 18 aa |
| Standard deviation of domain lengths | 18.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5DQ22 | 505-781 | MGSFRRLLDRNDTTRGRTPHFVMGVPGAAAYRDLTGAGATIATMRWDVMDEVKAMNGGANPWTACWMQHGRNDQQTTSAAWIARLNG… |
| A0A8A3LRU0 | 1-244 | MQTLAASAMKIWQGLDELSTMNPNGKRPYNNYLQRMGRNDNNAASATWLTPIRNLNTRLRTRDPTIPIIGATIPATTTTTTERHQTE… |
| A0A1W6PRI6 | 1-283 | None |
| A0A175RW10 | 273-521 | None |
| A0A0Q4UVM5 | 57-333 | None |
| A0A175RPV5 | 777-1059 | None |
| A0A2E7P7U0 | 426-662 | None |
| A0A444IKF2 | 123-404 | None |
| A0A1P8PU39 | 63-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.