DPCstruct | MC19327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 237 ± 22 aa |
| Standard deviation of domain lengths | 21.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L1MMD3 | 295-538 | RQLISEPSAEMLRRAHPFHQQQVAWSSLNPALWWLAGSAAQVSKDRHPASQNNPLRGWQELFSNQVQDALNGYRDLRDAAHEMCFYG… |
| A0A3N5XGR6 | 6-247 | VNPLMNVIKSWADLARANRKPMSKDNYLLAQERRASEQIEHALTAYGHSRDDAIVRWVEFVYGPMGLGALFPPDEPAEVAARARATA… |
| A0A1V5E8V0 | 2-174 | None |
| A0A1B8P3R2 | 331-566 | None |
| A0A562PUE7 | 535-758 | None |
| A0A838ZWN2 | 1-253 | None |
| A0A2U3I0Y5 | 553-778 | None |
| A0A1E3VCA6 | 111-355 | None |
| A0A349A1Y3 | 206-464 | None |
| A0A455VDT1 | 149-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.