DPCstruct | MC19322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 79 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.96 |
| Pfam Score | 93.48 |
| Assigned Pfam label(s) | PF16182- PF02209- CL0092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061RG10 | 307-370 | EGPIDYGLLLAGHPQSWPRGVRPGQREKYLSDQQFQEVFKMTKEEFWSLKLWKQNDLKKAVKLF |
| A0A6P8EZY5 | 11-88 | ESVRNKVTLVKDVLSRLSKKLYSVEELTSKPLPEGVDPLRLEMYLCDEDFQGLLELTREEFNALPNWKQLKLKKSKDL |
| A0A2I3TTH3 | 12-78 | None |
| A0A5B7BTV7 | 465-544 | None |
| A0A7S4E3I5 | 865-951 | None |
| A0A7R9ZJE6 | 56-152 | None |
| A0A6P8I496 | 1193-1254 | None |
| A0A1Y2H7V4 | 961-1045 | None |
| A0A4C1US58 | 990-1078 | None |
| A0A482X6Y6 | 1156-1232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.