DPCstruct | MC19321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 8.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5Q339 | 375-451 | IPENFRVKISNKGVGIKYVHPENEHISIRVMPGKPHSPFLYQQQPYVIQKIHGQAVDKFGNYIPSSDPSAHIPFNEY |
| A0A7K1JZF0 | 178-256 | VPQDWGAPSVVDSGVGVRWVDPHNPDGNSIRINRATPESSSTAQHVDHVRIIAGDNVIGIGGKKLPNDRGAEASVPLSD |
| I1SZ79 | 276-374 | None |
| A0A4P7W8N3 | 1151-1228 | None |
| A0A6M1ZHY4 | 593-689 | None |
| A0A832DPA2 | 46-127 | None |
| A0A521M3G6 | 300-382 | None |
| A0A4Q3EC68 | 1-90 | None |
| A0A7X5Q4C1 | 667-744 | None |
| A0A5C1WEK1 | 989-1094 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.