DPCstruct | MC19320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 228 ± 34 aa |
| Standard deviation of domain lengths | 34.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B4Q4F6 | 1-275 | MIATAAPRLKSSYLTVLEIGGAFGYRFQKLIEYLGITTLIITDLDSVYCTPPVQDATEARADELDGLAENPAANDDEEEEQANTETP… |
| A0A2S6M6W9 | 76-296 | IRRGFPRVDQGYVTILEVGGSHAHRLKPLVHHLGLTTLVVTDLDAQEKKVTPATDSVKEKISYHAAQPKLGAGLTTNNDTLKTWLPQ… |
| A0A2T1A959 | 1-225 | None |
| A0A081RR32 | 516-755 | None |
| Q9I2G5 | 492-662 | None |
| A0A7Y1IJ32 | 623-834 | None |
| A0A086XWJ9 | 213-493 | None |
| A0A517Z7R3 | 840-1051 | None |
| A0A7X2SS93 | 3-187 | None |
| A0A3M5KSK7 | 4-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.