DPCstruct | MC19319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 121 ± 5 aa |
| Standard deviation of domain lengths | 5.41 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3TXT7 | 2-124 | RGMKAALLLMDDVQGRVNGASAWVKRGDRVQRDVPPPPSIPQLPAALPAPAPLTQQETTGLIDYGTWRVNTDNCSLDPLRREVSVAP… |
| A0A8B4Q1G1 | 1-128 | MCSPAKVAYAVLLKMDDVQGRIGTPGALTKKGDRPESSVRAAIPAPVIHRVMPEKAQERALTAPELAVLKPKLLSTLNNDDWCDRLQ… |
| A0A4P5NN24 | 4-120 | None |
| A0A1W1C0C5 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.