DPCstruct | MC19318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 577 ± 46 aa |
| Standard deviation of domain lengths | 46.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7KFD5 | 105-724 | HDHSNYKTTIGMGEVIAVLNGVEFRTRHNDYKLVMPSTKSINYGATEPVPFPPVPPEVLAQPSVELQEEEMRLWFKAFQEQDPSVRD… |
| A0A2T7PXI5 | 33-572 | SRLETLTSALSRQLMLQQLYVEEKTRTEVDSGIKQVRLNRDGSKPYYTPTHTAGSVAAMHDHSDLIRTCGMGEFAAVLNGIDFRTRH… |
| A0A7S0JYN5 | 5-549 | None |
| A0A5A8CH63 | 500-1091 | None |
| A0A1S3IL14 | 1-489 | None |
| A0A7M5TXL9 | 235-805 | None |
| A0A3S1A087 | 2-630 | None |
| A0A1I1Q4S1 | 402-1006 | None |
| A0A1S3K3F6 | 23-575 | None |
| A0A2T7PGB4 | 179-788 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.