DPCstruct | MC19317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 263 ± 27 aa |
| Standard deviation of domain lengths | 26.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182TJG4 | 527-759 | GGLQQIRNQLEGLETMYSEVLKMLGNRMATNESTLRANRRRRHGSMSSLPSSSISGRPIRDRRRLDERRKVRDIKGINKRFQRLESH… |
| A0A7J7KEN5 | 48-277 | ESFSQPIETSPQTKPANDKPPEAAGTEGDFKSVREERAELGERKPSVSESVTSSQGSYSGRYKASRKGKSSRAVDNRASHKKIQKIE… |
| A0A1W0X488 | 552-823 | None |
| A0A6P8N2E7 | 715-1007 | None |
| A0A5N5TNU1 | 243-477 | None |
| A0A834Y4U2 | 765-1053 | None |
| A0A7E5VPK5 | 668-907 | None |
| R7V4G2 | 566-842 | None |
| A0A6J8CI83 | 851-1091 | None |
| A0A7T8HIH1 | 2-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.