DPCstruct | MC19314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 230 ± 49 aa |
| Standard deviation of domain lengths | 48.68 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7K9Q2 | 56-268 | NSTAKVAKPFLRALEMDGEGMNSWANLVAVTFSGVISTNISVDAYGVSVNDATFLASDPEVSFLSDANITFSVPMHNDMPLNPMDIS… |
| A0A812JRI9 | 120-337 | SPYLEAQDLERTAADHNVSSEGSSPFCSRAQHVLAGLSAADAQRLQVQDGFHITSPNLEHCHPTWTVDGKKLLVRSCSHTNYYPDIS… |
| A0A359F6W4 | 170-358 | None |
| E1ZUE3 | 75-295 | None |
| A0A7S0J1I7 | 305-524 | None |
| A0A1Q9EBP4 | 681-999 | None |
| A0A812NM73 | 183-461 | None |
| A0A845WC65 | 480-741 | None |
| A0A7S2AZI7 | 2-195 | None |
| A0A7S4KNF5 | 63-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.