DPCstruct | MC19313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 238 ± 23 aa |
| Standard deviation of domain lengths | 23.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6HQU5 | 13-228 | SLGYIEGNKYVKEPDCLEAIKDLIRFLKREDDSFEIRRELGNAQIVQNDLLHIIKWYSHDEKLFDAVIRLLVNLTQPAILCFNNTVP… |
| A0A7J7K9K3 | 48-266 | LIYTELQSIANGIGKFHNGDYIREQDAVDCVKDLIKSLRRENETCNIRRFLGQAQVLQEDLVPLIVYYGRADEELFEVTIRCLMNLT… |
| A0A177WYK4 | 2-249 | None |
| A0A154PJL0 | 123-353 | None |
| A0A6A4JIL9 | 5-242 | None |
| A0A4P9Y8G3 | 46-282 | None |
| A0A835RMU6 | 15-252 | None |
| A0A6A4VET4 | 9-237 | None |
| A0A1D6MD85 | 1-259 | None |
| A0A1D6MD97 | 1-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.