DPCstruct | MC19312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 157 ± 13 aa |
| Standard deviation of domain lengths | 12.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9B310 | 249-403 | AGMLNESLTILTVRYTQAMPSRGRSSLLVADVSNLLVCVHQLLPAICCESEELVGRRTTNKVLRDVHTKCHELLCCLLLRGCPLAVL… |
| A0A7J7K5N6 | 19-167 | TSLSYYIQCVMLLDITVILYTVYELMFHVCSSSSQLLDLESVALEQPYLTIHSCCCKLLATLTIVGSPLADLYKVYKRGYQRRSKRR… |
| A0A0P4VYP5 | 1-143 | None |
| A0A0C9RUR4 | 235-382 | None |
| A0A6J1P6Q2 | 72-231 | None |
| A0A3S2P499 | 1-188 | None |
| A0A0L7LI87 | 227-386 | None |
| A0A834JRA8 | 85-232 | None |
| A0A5E4R690 | 153-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.