DPCstruct | MC19310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 186 ± 45 aa |
| Standard deviation of domain lengths | 45.13 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821MB92 | 5-125 | GEPKFPLDDLLKLEEQVGRVRWIVPVLPSGELIKCLRTAVCLAREKIDTKSESCQRFIRDSLVTSFTKIFCDEAVGGWKNDIYIAIY… |
| A0A7J7K6R0 | 1-217 | MPLNVVPSSTKPSTVPSDSSQPSSSALPDLLPTDNLNVDSSQPTADSGRRGNSPVQHDELEAQDEEEGGLVFPVDKLAKLDDMINKP… |
| A0A3P7W534 | 1-182 | None |
| A0A183S0Y8 | 3-163 | None |
| A0A819JKZ3 | 1-205 | None |
| A0A654I0G9 | 1-309 | None |
| R7T4N6 | 42-241 | None |
| A0A183AXY2 | 1-156 | None |
| A0A8B6DXS8 | 5-261 | None |
| A0A818CFT4 | 5-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.