DPCstruct | MC1931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 88 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.81 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0341- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0H294 | 2-83 | RSLVTPTPEGDWFSTGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVKDVLMDDYLRRRIKKSEDELLAEKRCVAHLTGEGI |
| A0A0A9GAF9 | 71-158 | RSLVTPTSEGDWFSSGVYTTGNPYGIAEDIVFSMPCRSKGDGDYELVSDVEMDDFLWERIKKSEAELLAEKKCVAHLTGEGNAFCDLP |
| A0A6P8RF68 | 376-456 | None |
| A0A2D4EYS5 | 3-97 | None |
| A0A654HP22 | 305-381 | None |
| A0A498NFB1 | 240-343 | None |
| A0A0R3T9Z9 | 241-328 | None |
| A0A2R6X7Q8 | 565-678 | None |
| T1FI42 | 19-104 | None |
| A0A819LB53 | 262-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.