DPCstruct | MC19309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1KQ89 | 1-86 | MVMLTDEALAELAKIENIIGDYICRLCCQKFENAFSLALHRCSKIVHVVHRCPECAKVFNCPANLASHRRWHKPRSSLGLKDGKDG |
| A0A834R1I7 | 677-776 | CAVKRSGDIDPSLNIVIITPEAREEIAKIENKIGDYVCALCKEFHTDAFALAQHRCSRIVHIEYRCPECNKVFNCPANLASHRRWHK… |
| A0A369S0K0 | 176-256 | None |
| A0A3B3HT76 | 251-348 | None |
| A0A077Z4I4 | 207-301 | None |
| A0A6J0RMJ1 | 254-355 | None |
| A0A183JFF5 | 227-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.