DPCstruct | MC19308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 169 ± 13 aa |
| Standard deviation of domain lengths | 12.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5UDZ4 | 15-188 | PTEPWSVREKLCLASSVMRSGDQNWVSVSRAIKPFSEPGRPPDWFSQKHCASQYSELLEATEAPKRKRGEKGEVVETIEDVIVRRLT… |
| A0A7J7K1R0 | 1-150 | MLASSVLQSGDQNWVSVSRAIRNHSTESRPHEYFSQKNCALQYGELLEKAETPKRKRSEKNEVIPVETQGLQIVNKLRLEYMQHLVE… |
| A0A0A9YGY4 | 3-187 | None |
| A0A6P4YYI8 | 1-178 | None |
| A0A6F8ZYM1 | 15-188 | None |
| A0A212F487 | 11-191 | None |
| A0A1X0REX1 | 1-152 | None |
| A0A060XR29 | 14-188 | None |
| A0A4Z2GDZ5 | 12-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.