DPCstruct | MC19307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 167 ± 26 aa |
| Standard deviation of domain lengths | 26.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212DIZ1 | 10-177 | SQDSRQLQAGSSCRKSAMKELALSGLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFM… |
| K7FGC2 | 24-183 | VLESLLSMGFPAHTANKALAATGHKTVEEASKWLHSHCNDPSLDDPIPQEYALYLCPSGPLHDRLQEFWKESKNQCARNRAHEIFPH… |
| A0A813RS71 | 68-301 | None |
| A0A194RKM8 | 1-179 | None |
| A0A6I9Z7A7 | 8-154 | None |
| A0A3Q0JLA2 | 3-129 | None |
| A0A2J8M8A9 | 1-149 | None |
| A0A670YU31 | 14-183 | None |
| A0A7R9A1D2 | 1-148 | None |
| A0A834CIX7 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.