DPCstruct | MC19303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 5.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 60.43 |
| Pfam Score | 75.56 |
| Assigned Pfam label(s) | PF14008- PF11901- CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8VST3 | 244-299 | GLEDLFYDYGVDLEIWAHEHSYERLWPIYNHQVYNGSLDSPYSNPEAPVHVITGSA |
| A0A7J7JUL4 | 1-67 | MRYFVEDTLYDAGVDVFIAGHEHFYERSWPIYDSKVCNGSYDHPYTEPNAPVHIITGSAVSQSLAST |
| A0A813YVP6 | 582-644 | None |
| T1GWM5 | 50-114 | None |
| A0A6A4JUX1 | 21-85 | None |
| A0A6A4JP42 | 983-1037 | None |
| A0A7R9PVT7 | 503-565 | None |
| A0A816V4U4 | 287-349 | None |
| A0A3S3PJZ3 | 51-125 | None |
| A0A2G9V4Y9 | 2-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.