DPCstruct | MC19301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 225 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820M5U9 | 159-388 | FSRDDPRSLIIPKYIGSSVVRGIPVDQWETCIINKNNLQTVRRVWSFAKQDFTTPLGSMNNFAVPVQGITYASVLLPNGMQVAEFDE… |
| A0A368GS01 | 142-367 | NTQGVFRDNRFVAGVEGVRWVACVNGTNGTGNLQVEVVFAGDSDQSLKPPSPAFDNPLLLSLRIAEFGNFSDNTTVRSQLSVEFDSY… |
| T1KP30 | 1-230 | None |
| A0A4Y2M724 | 153-349 | None |
| A0A7R8CDJ2 | 22-259 | None |
| T1K411 | 105-285 | None |
| T1KVC0 | 91-311 | None |
| T1KP32 | 1-230 | None |
| A0A818C2U3 | 1-219 | None |
| A0A1S3ITY5 | 248-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.