DPCstruct | MC19300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 8.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JRC3 | 1-136 | MYVMLAALTELQSLAYMELTLRCSNRKSQSIIASAMFRIVVERKAADDAITSYGRQEHTISNACSGLSLGHNTIFSNNFLKAHKTAT… |
| A0A6J8CXW8 | 72-191 | INTKSILTEDSERSFGSLKRISENTSNRKAGYIIENAIIRYRAQEDDDDRADSSQKQESEISKLAKSLPPKSRTTLPQNFIKDKFSL… |
| K1Q0D4 | 9-127 | None |
| A0A7M5USX4 | 1-131 | None |
| A0A6S7GXW1 | 476-595 | None |
| A0A6S7G2P8 | 106-234 | None |
| A0A6S7G116 | 396-525 | None |
| K1S0T7 | 421-531 | None |
| A0A7D9HK17 | 16-130 | None |
| A0A6S7JHM0 | 400-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.