DPCstruct | MC1930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 57.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6F2M0 | 128-185 | LGSPEAGGGGGGGGSSGMILAGCPRCMMYVMLSREDPKCPKCHSTVLLDFNDAAAAAD |
| A0A0V0H1W3 | 3-69 | RSPASSCVSREPTPDDHNQQQFFGSPEATTTSMMLVGCPRCLMYVMLSVEDPKCPKCKSSVLLDFFP |
| A0A7I8KT11 | 58-125 | None |
| A0A7J9H2T1 | 2-60 | None |
| A0A6A3CBC7 | 25-106 | None |
| A0A803L324 | 36-106 | None |
| A0A067KMC1 | 127-192 | None |
| B6U7M5 | 2-67 | None |
| A0A287IFU4 | 30-90 | None |
| A0A7J9GC89 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.