DPCstruct | MC193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 7.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376G731 | 4-54 | RNYTYYDYTISLCPECLKRIGAKIIIEDENVFMTKRCPDHGFFKTKIATDV |
| A0A432JFE5 | 3-66 | KPADKGKVRVKQDADYIFHELTRSICPECKTVIDAQIIIQDNKVYMRKRCPTHGWFKGIISSDA |
| A0A0M8V584 | 2-73 | None |
| A0A7X6U0V0 | 1-57 | None |
| A0A1Z4PZN9 | 2-68 | None |
| A0A6G1T0X5 | 12-83 | None |
| A0A560KEW3 | 3-73 | None |
| A0A0F8ZJR2 | 24-85 | None |
| A0A7J2X0R8 | 60-122 | None |
| A0A3D2YW65 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.