DPCstruct | MC19299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 249 ± 32 aa |
| Standard deviation of domain lengths | 31.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JPP1 | 1-296 | MKMPSLSSSEYGASEDVPYPEVPPEVLAQPSLDLQIEEMREWFKAWKTSNHSVRDYRRYFKPNLCYLEGQWTNVDGDAIDEPFHSER… |
| A0A2C9KY79 | 68-334 | LGEGQYVLNGVEFRTRHNDYPLRMPSTRSSDYHIMSEIPTPAVPPQVLEKSSVEEQILEMREWFKAWRDQNYSVRDYRKYFKPVLCY… |
| A0A7J7KMW7 | 1-205 | None |
| A0A1S3ILH3 | 21-240 | None |
| A0A7S0JYN5 | 5-253 | None |
| A0A1S3JLF3 | 23-277 | None |
| A0A433SLI0 | 1-214 | None |
| A0A7J7KFD5 | 116-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.