DPCstruct | MC19297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 75 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IBY0 | 198-262 | AVLARHLQQNGDNWRLVLPPWGNLYHWQSRDVGSQTQLPWSLFFDIPSLQEFAPVLEMHSFFQEY |
| A0A7J7JMF8 | 1-87 | MVKFLNDENGDTQWVLVLPPWSENFHWQSEIEQTKIAWSHFFDLESLRRHVPVIELTDWIKFFIGNVCHPNNNTVSTHIASSLCTRM |
| G1L519 | 68-145 | None |
| A0A0R3UCD0 | 52-141 | None |
| E2A6V7 | 26-103 | None |
| A0A6J3AGR2 | 57-122 | None |
| A0A0K0CUN3 | 61-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.