DPCstruct | MC19295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 15.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.17 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0063- PF17391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JLP7 | 93-195 | MKAYPIHLYPAKCTQAAAIMLMIMNNLDHKVAQFPHELVTYGGNGQVLGNWAQFWLVMNYLSEMTDAQTLVMYSGHPSGLFPSQPSA… |
| A0A7H4NQB4 | 1-96 | MLMNNLDPDVAENPKELVVYGGIGRAARNWECYDKIVETLKQLNDDETLLIQSGKPVGVFKTHDNAPRVLIANSNLVPHWANWEHFN… |
| I4WGG0 | 3-133 | None |
| H3G5E2 | 2-110 | None |
| W4SL99 | 5-126 | None |
| A0A535YS62 | 476-609 | None |
| V5BMH1 | 85-221 | None |
| A0A3P9KAA8 | 81-222 | None |
| A0A820ZSE5 | 88-236 | None |
| A0A820X0J8 | 83-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.