DPCstruct | MC19291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 150 ± 16 aa |
| Standard deviation of domain lengths | 15.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3IPD5 | 1-155 | MGCIYVGKPYFSDPSDRDISPNGYTPEIEARLNRAAASEGGIYVLLMMLAAFGYVLSDVCADGVVVELAQREPLTERGRTQSTIYAT… |
| A0A0P1B3P1 | 144-298 | ATFPESKPYFGDSSMHFIHPDKWTEAQRKSINSNAPDAAGRYVMPMMMAAFGYLLVEVSADAVTIEFSQREPLSTRGHLQSWIHSLR… |
| A0A6G0P487 | 143-263 | None |
| A0A0W8DTR7 | 52-186 | None |
| A0A6A3H012 | 163-345 | None |
| A0A3M6VWV1 | 142-291 | None |
| A0A6G0WKX0 | 16-160 | None |
| A0A225X3V7 | 132-281 | None |
| A0A6A3SG15 | 16-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.