DPCstruct | MC19288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 249 ± 40 aa |
| Standard deviation of domain lengths | 39.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 35.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3HSC6 | 3-241 | TVDGKSCVKPTPSSPEGLAAFLDVTSTQHPCQRLRTKLPELGFFMSPKVLHRVESRRSSPKTAPPVEIVVECWLKCRGERPDLMKIF… |
| A0A225UDV7 | 58-309 | VPSDAEIKCTTVGIQKCCKFMDPDHPWRKAMDLWPEHACLFDTTDFQLDSHISQRADYPERLCGVWQRLRGYGSKKQAVMSFAIYER… |
| A0A6A3KAS0 | 193-443 | None |
| A0A225W8S3 | 106-367 | None |
| A0A225WIH0 | 410-651 | None |
| W2P115 | 16-217 | None |
| A0A6A3YVQ6 | 116-441 | None |
| G4ZDJ0 | 568-811 | None |
| A0A6A3RH29 | 734-1061 | None |
| W2M5E2 | 5-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.