DPCstruct | MC19287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 206 ± 34 aa |
| Standard deviation of domain lengths | 34.22 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3MSZ4 | 188-369 | LRAFCGRVGIKAYKNKSKAELLELIAQKKKDDKLYKPIFDAKMAERREPSRKQIQCPFRLLNIMFSDHFADRFVSLADQRSRADLDA… |
| A0A6A3HR69 | 18-245 | GAKALRSECRRLKATPTAHNKASYLAALRASLVVAGTIEASGVVQDPFLGADVVRKTVACVFRLLNVLFSDVFCAGVATLGDVATRQ… |
| G4ZWN6 | 2-284 | None |
| W2HKX2 | 18-230 | None |
| A0A225WXA5 | 5-241 | None |
| A0A6A3YRX0 | 1-155 | None |
| A0A6A3ZK55 | 33-292 | None |
| D0P141 | 8-250 | None |
| A0A6A3IND6 | 523-754 | None |
| D0MRL6 | 7-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.