DPCstruct | MC19286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 181 ± 22 aa |
| Standard deviation of domain lengths | 21.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0QH22 | 73-232 | LQLRPDPYTPSDKDALDPQNSLTRTAEEVRASLADHAVIWDKQRTDLQLVMRSGLDYLDAFELVNGDHLVHPRIPVRELTLMLARMM… |
| A0A6A3HJ83 | 1-193 | MLYVDRLKLAQRPQRFKPNKARALKNSPAQVSESKAMSAVPRQFLWDDVRADVRELMLNGVQFWDDVAEARKNQTLHDQFGKFALTE… |
| A0A225W418 | 396-598 | None |
| A0A6A3KH88 | 250-425 | None |
| A0A6A3L078 | 196-364 | None |
| A0A225W2A0 | 82-286 | None |
| A0A225VLG4 | 136-311 | None |
| A0A225W3W8 | 85-310 | None |
| A0A225WJS7 | 197-370 | None |
| A0A6G0QW04 | 134-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.