DPCstruct | MC19283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 179 ± 18 aa |
| Standard deviation of domain lengths | 17.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828Y3X5 | 29-194 | TEELHTEILKYQPKRVVIAYDNDTAGNSGARKVAMRLLEEGIKCNRMKLPLEMDVNEYGLKVTNPGEQLSALILDSEEMREEDEDSQ… |
| W7Y4S3 | 1-184 | MYRRTTVRLNTIRLRNQWLNHRTHRAVSQLKNLQEVIFFFDGDQAGQKGAAKYSEELAKQGVKTSIVCTPPNEDVNSLWVNYGKEAI… |
| A0A656QJX9 | 12-193 | None |
| A0A3A3FF55 | 44-220 | None |
| A0A4V1UDP3 | 1-168 | None |
| A0A7W4L8E9 | 2-226 | None |
| A0A379LQ17 | 160-313 | None |
| A0A7X5VW84 | 36-207 | None |
| A0A8B1BE00 | 78-258 | None |
| A0A838UDM0 | 303-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.