DPCstruct | MC19280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 145 ± 21 aa |
| Standard deviation of domain lengths | 20.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2NGK2 | 229-375 | NLRDLTPDENKGISNWVNFYLNHETYKFVGLHSGWFFDEKGEKTWRMREFEEALIEAEALDNAQSETDKLFPGCNMEWNAEHGSNLW… |
| A0A7R9GBN8 | 65-222 | IDDVDGLSDADLRGLDEWSKFYDREYSYVGKLSGRYYDAKGRPTAYQKQFTKNLRKAFQSKDAEESLRKIFPPCNSEWKQDSGGRVW… |
| A0A2A6CHB1 | 1043-1188 | None |
| A0A835NXS8 | 77-250 | None |
| A0A833W0I8 | 90-216 | None |
| C1MII6 | 79-240 | None |
| A0A1B0AV97 | 107-243 | None |
| A0A4S4EDJ7 | 687-813 | None |
| A0A7R9FR21 | 1-125 | None |
| A0A4Y2SKC9 | 126-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.